PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G01530.1
Common NameATMYB57, F4P13.8, MYB57
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 206aa    MW: 23716.8 Da    PI: 10.0597
Description myb domain protein 57
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G01530.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.5e-162774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l +++  +G g W+++a+  g++Rt+k+c++rw++yl
      AT3G01530.1 27 KGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 74
                     79********************************************97 PP

2Myb_DNA-binding56.94.7e-1880123146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++++lG++ W++Ia++++ gRt++++k++w++
      AT3G01530.1  80 RGNITEEEQLLIIQLHAKLGNR-WSKIAKHLP-GRTDNEIKNFWRT 123
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8642274IPR017930Myb domain
SuperFamilySSF466891.98E-2925121IPR009057Homeodomain-like
SMARTSM007179.4E-122676IPR001005SANT/Myb domain
PfamPF002492.0E-142774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-222881IPR009057Homeodomain-like
CDDcd001673.33E-82974No hitNo description
PROSITE profilePS5129425.25975129IPR017930Myb domain
SMARTSM007171.2E-1679127IPR001005SANT/Myb domain
PfamPF002499.5E-1780123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2582129IPR009057Homeodomain-like
CDDcd001671.18E-1284123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0030154Biological Processcell differentiation
GO:0080086Biological Processstamen filament development
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009052anatomyflower pedicel
PO:0009062anatomygynoecium
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001185developmental stageplant embryo globular stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
METTMKKKGR VKATITSQKE EEGTVRKGPW TMEEDFILFN YILNHGEGLW NSVAKASGLK  60
RTGKSCRLRW LNYLRPDVRR GNITEEEQLL IIQLHAKLGN RWSKIAKHLP GRTDNEIKNF  120
WRTKIQRHMK VSSENMMNHQ HHCSGNSQSS GMTTQGSSGK AIDTAESFSQ AKTTTFNVVE  180
QQSNENYWNV EDLWPVHLLN GDHHVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-2911271126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425634070.0
Genevisible259187_at0.0
Expression AtlasAT3G01530-
AtGenExpressAT3G01530-
ATTED-IIAT3G01530-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed specifically in flowers. {ECO:0000269|PubMed:19325888}.
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
UniProtTranscription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}.
Function -- GeneRIF ? help Back to Top
  1. PIN6 and auxin, as well as the transcription factor MYB57, play a role in the regulation of nectar synthesis and secretion in Arabidopsis thaliana.
    [PMID: 23551385]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00324DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G01530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDGibberellin, Jasmonic acid
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. Myb21 and myb57 double mutant has an intermediate sterility phenotype and petals that grew to a final height parallel to the pistil. Myb24 and myb57 double mutant has petals that grew to a final height parallel to the pistil. Myb21, myb24 and myb57 triple mutant has a strongly reduced fertility and an arrested growth of the petals that never grew out of the sepals. {ECO:0000269|PubMed:19325888}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G01530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195820.0AY519582.1 Arabidopsis thaliana MYB transcription factor (At3g01530) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186802.11e-154myb domain protein 57
SwissprotQ9SSA11e-156MYB57_ARATH; Transcription factor MYB57
TrEMBLQ8L8W81e-152Q8L8W8_ARATH; Putative transcription factor
STRINGAT3G01530.11e-153(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  7. Cheng H, et al.
    Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis.
    PLoS Genet., 2009. 5(3): p. e1000440
    [PMID:19325888]
  8. Peng J
    Gibberellin and jasmonate crosstalk during stamen development.
    J Integr Plant Biol, 2009. 51(12): p. 1064-70
    [PMID:20021553]
  9. Kundu N,Dozier U,Deslandes L,Somssich IE,Ullah H
    Arabidopsis scaffold protein RACK1A interacts with diverse environmental stress and photosynthesis related proteins.
    Plant Signal Behav, 2013. 8(5): p. e24012
    [PMID:23435172]
  10. Bender RL, et al.
    PIN6 is required for nectary auxin response and short stamen development.
    Plant J., 2013. 74(6): p. 893-904
    [PMID:23551385]
  11. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]